PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029909.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 382aa    MW: 41940 Da    PI: 7.399
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029909.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
      Pbr029909.1 14 KGPWTPEEDQKLLACIEEHGHGSWRALPAKAGLQRCGKSCRLRWSNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.67.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E + +++++++ G++ W++Ia++++ +Rt++++k++w+++l
      Pbr029909.1  67 RGNFSLQEAQTIIRLHALVGNR-WSAIASHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.236965IPR017930Myb domain
SuperFamilySSF466891.17E-2911108IPR009057Homeodomain-like
SMARTSM007176.7E-141363IPR001005SANT/Myb domain
PfamPF002492.6E-161461IPR001005SANT/Myb domain
CDDcd001671.90E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.7E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129418.97166116IPR017930Myb domain
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002495.5E-1467112IPR001005SANT/Myb domain
CDDcd001677.34E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGPWTPE EDQKLLACIE EHGHGSWRAL PAKAGLQRCG KSCRLRWSNY  60
LRPDIKRGNF SLQEAQTIIR LHALVGNRWS AIASHLPKRT DNEIKNYWNT HLKKRLTKMG  120
IDPMTHKLKH HEGHAKDAAN ISHMAQWESA RLEAEARLGK ESKLVITNTN PFQHHLMISS  180
SPNPAHQVVH VRNAPPALPC LDVLKAWQEG CSLTTNSTIR NNVNSTMFSG GSMTDGDDLE  240
SPTSKLNLRH VNNAFDPPPM LKVNNGFPCE SGVLQNNDNV TSGCTDANAA WFADGFRSGN  300
VDEEKNVVVP AELSSMVMEG FTDVLVYDSE DHQQNASLGG EISGNGGDDG SCGGRGFEEN  360
RNYWNRILNL VNASASGSPV F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356321.10.0PREDICTED: uncharacterized protein LOC103947194
TrEMBLW9S8D01e-133W9S8D0_9R
STRINGPOPTR_0010s17300.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-101myb domain protein 16